If you have been reading about Ipamorelin and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-02-05. Where a claim depends on a specific study, the study is described rather than over-claimed.
Lyophilized material is generally stored cold and dry, with desiccant, and protected from light. In solution the peptide is more vulnerable: the histidine side chain can oxidize, and repeated freeze-thaw cycles promote aggregation and loss of material to container surfaces. A mildly acidic aqueous buffer is often used for short-term handling because it limits several degradation routes. Accurate prediction of long-term stability under a given set of conditions is difficult, and published stability data remain sparse.
Published discussion of this compound is uneven. Some references describe it as a tool for probing growth hormone regulation, while others focus on analytical characterization or on comparisons with related secretagogues. Statements about selectivity, half-life and potency often trace back to a small number of original reports that later authors cite secondhand. Readers evaluating a claim should therefore check whether a figure reflects a direct measurement or a repeated citation, and whether the underlying study was conducted in animals, in isolated cells or in human volunteers.
Lyophilized ipamorelin powder is the form usually supplied for laboratory work. Kept dry, protected from light, and held at minus 20 degrees Celsius or below, it remains stable for extended periods, often measured in years. Once dissolved, the peptide degrades faster through hydrolysis, oxidation, and deamidation, so solutions are typically refrigerated and used within weeks. Repeated freeze-thaw cycles and exposure to alkaline conditions accelerate loss of the parent compound.
Reversed-phase high-performance liquid chromatography is the standard tool for assessing purity. Detection near 214 nanometers captures the peptide backbone, and the resulting chromatogram shows the main peak alongside related impurities. Electrospray ionization mass spectrometry confirms molecular mass and supports sequence verification. Common degradation products include oxidized residues, deamidated forms, and truncated fragments, each appearing as a distinct peak or shoulder in the trace.
Quality claims for research peptides vary widely across suppliers. A certificate of analysis should list purity by chromatography, the mass found by spectrometry, and the analytical conditions used. Independent testing at a third-party laboratory is a common way to check identity and purity, because documents alone cannot confirm what is inside a vial. Purity figures describe the proportion of the target peptide among detected species, and they say nothing about biological activity or sterility.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized solid as supplied |
| Solubility | Freely soluble in water and polar solvents | Dissolution may require brief mixing |
| Typical storage temperature | Minus 20 degrees Celsius or below | Dry, desiccated, protected from light |
| Common analytical method | Reversed-phase HPLC with mass spectrometry | Purity plus identity confirmation |
| Common synonyms | Ipamorelin acetate, NNC 26-0161 | Research code used in early literature |
Signal transduction begins when the peptide binds GHSR-1a on pituitary somatotrophs. The receptor couples to Gq/11 proteins, activating phospholipase C, which cleaves phosphatidylinositol bisphosphate into inositol trisphosphate and diacylglycerol. Inositol trisphosphate releases calcium from intracellular stores, and the resulting rise in cytosolic calcium drives growth hormone vesicle fusion. Concurrent Gs coupling and cyclic AMP elevation have also been reported, and the relative contribution of each arm to the overall secretory response is not fully settled.
Structural features distinguish the molecule from earlier secretagogues. An alpha-aminoisobutyric acid residue near the N-terminus and a D-naphthylalanine substitution increase receptor affinity, while C-terminal amidation improves resistance to exopeptidases. These modifications are associated with reduced stimulation of appetite and of the hypothalamic-pituitary-adrenal axis compared with hexarelin or growth hormone releasing peptide-6. Whether the same profile applies at every dose level studied is a matter of ongoing investigation rather than settled consensus.
Ipamorelin is a synthetic pentapeptide that acts as an agonist at the ghrelin receptor, also called the growth hormone secretagogue receptor type 1a. Its sequence incorporates non-natural residues, which slows enzymatic breakdown relative to short native peptides. In laboratory and early clinical work the compound is described as a selective growth hormone secretagogue because it raises growth hormone with comparatively little effect on other pituitary outputs. The degree to which that selectivity holds across species and dosing regimens remains an open question in the published literature.
Ipamorelin is a synthetic pentapeptide that belongs to the growth hormone secretagogue family. Its sequence is Aib-His-D-2-Nal-D-Phe-Lys-NH2, incorporating two non-natural residues that resist enzymatic breakdown. Researchers at Novo Nordisk described the compound in the 1990s while searching for agents that release growth hormone with fewer side effects than earlier secretagogues. The molecule acts as an agonist at the ghrelin receptor, also called GHS-R1a, which is expressed in the pituitary and in several peripheral tissues.
Selectivity distinguishes ipamorelin from first-generation secretagogues such as GHRP-6. At doses that reliably raise growth hormone, it shows little stimulation of adrenocorticotropic hormone or cortisol release in animal models, and it does not markedly raise prolactin or appetite. Binding at GHS-R1a on pituitary somatotrophs triggers calcium influx and pulsatile growth hormone secretion. Because the compound mimics the natural ghrelin signal, the release pattern tends to follow the body's own rhythm rather than producing a sustained elevation.
Most published work on ipamorelin comes from rodent studies and small early-phase human trials. Subcutaneous and intravenous routes have been used, while oral delivery is limited by poor absorption and rapid breakdown in the gut. The reported plasma half-life is short, on the order of two hours, and varies with species and assay method. Whether chronic use produces meaningful clinical benefit remains unresolved, and long-term safety data in humans are sparse. No major regulatory agency has approved the compound as a therapeutic drug.
Peptide aptamers consist of one or more peptide loops of variable sequence displayed by a protein scaffold. Derivatives known as tadpoles, in which peptide aptamer "heads" are covalently linked to unique sequence double-stranded DNA "tails", allow quantification of scarce target molecules in mixtures by PCR (using, for example, the quantitative real-time polymerase chain reaction) of their DNA tails. The peptides that form the aptamer variable regions are synthesized as part of the same polypeptide chain as the scaffold and are constrained at their N and C termini by linkage to it. This double structural constraint decreases the diversity of the 3D structures that the variable regions can adopt, and this reduction in structural diversity lowers the entropic cost of molecular binding when interaction with the target causes the variable regions to adopt a uniform structure.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
The effects are varied depending on the particular drug given. When anesthetists administer standard doses of these anesthetic drugs to a person with butyrylcholinesterase deficiency, the patient experiences prolonged paralysis of the respiratory muscles, requiring an extended period of time during which the patient must be mechanically ventilated. Eventually the muscle-paralyzing effects of these drugs will wear off despite the deficiency of the pseudocholinesterase enzyme. If the patient is maintained on a mechanical respirator until normal breathing function returns, there is little risk of harm to the patient. Because it is rare in the general population the deficiency is sometimes overlooked when a patient does not wake up after surgery. If this happens, there are two major complications that can arise. First, the patient may lie awake and paralyzed while medical providers try to determine the cause of the patient's unresponsiveness. Second, the breathing tube may be removed before the patient is strong enough to breathe properly, potentially causing respiratory arrest. This enzyme abnormality is a benign condition unless a person with burtyrylcholinesterase deficiency is exposed to the offending pharmacological agents.
Sources: en.wikipedia.org
In terms of inhibitors of intrinsic termination, much is still unknown. One of the few examples that is known is bacteriophage protein 7. This is made up of 3.4A and 4.0A cryo-EM structures of P7-NusA-TEC and P7-TEC. This bacteriophage protein 7 stops transcription termination by blocking the RNA polymerase (RNAP) RNA-exit channel and impeding RNA-hairpin formation at the intrinsic terminator. Furthermore, bacteriophage protein 7 inhibits RNAP-clamp motions. Shortening the C-terminal half-helix of the RNAP slightly decreases the inhibitory activity. These RNAP clamp motions have been targeted by some other inhibitors of bacterial RNAP. These inhibitors include myxopyronin, corallopyronin, and ripostatin. These work by inhibiting isomerization. RNA polymerases in all three domains of life have some version of factor-independent termination. All of them use poly-uracil tracts, though the exact mechanisms and accessory sequences vary. In archaea and eukaryotes, there appears to be no requirement of a hairpin.
The image above shows the interpretation of an antibody panel used in serology to detect antibodies towards the most relevant blood group antigens. Each row represents "reference" or "control" red blood cells of donors which have known antigen compositions and are ABO group O. The + symbol means that the antigen is present on the reference red blood cells, and 0 means it is absent; nt means "not tested". The "result" column to the right displays reactivity when mixing reference red blood cells with plasma from the patient in 3 different phases: room temperature, 37 °C and AHG (with anti-human globulin, by the indirect antiglobulin test).
Atypical sphingolipids' lack of C1-OH (hydroxyl group) of sphinganine its the cause they accumulate in the cytoplasm and cannot be degraded. These headless sphingolipids are not able to be phosphorylated and they can neither converted into complex lipids as sphingomyelins and glycosphingolipids (galactosylceramides, gangliosides, cerebrosides ...). Instead, they have toxic effects to the cell. Despite previous opinions that 1-deoxySLs are dead-end metabolites, new researches prove the opposite. Its concentrations decrease over time because atypical sphingolipids convert into downstream products, which normally are polyunsaturated and polyhydroxylated. The main reason for this transformation is detoxification. The enzymes involved in this process produce the change within several days, making it a slow conversion. This take places in two stages:
According to Annex 13 of the Convention on International Civil Aviation, an aviation accident is an occurrence associated with the operation of an aircraft, which takes place from the time any person boards the aircraft with the intention of flight until all such persons have disembarked, and in which (a) a person is fatally or seriously injured, (b) the aircraft sustains significant damage or structural failure, or (c) the aircraft goes missing or becomes completely inaccessible. Annex 13 defines an aviation incident as an occurrence, other than an accident, associated with the operation of an aircraft that affects or could affect the safety of operation. A hull loss occurs if an aircraft is damaged beyond repair, is lost, or becomes completely inaccessible.
Sources: en.wikipedia.org
Reversed-phase liquid chromatography is standard for purity, and mass spectrometry is standard for identity. Amino acid analysis is used when quantitative composition matters. No single technique answers every question, so laboratories usually combine two or three.
The peptide contains aromatic and imidazole groups that absorb ultraviolet light and can participate in photo-induced reactions. Those reactions can alter the molecule or generate new species. Amber glass or opaque packaging reduces the exposure.
Long-term stability data across many temperature and humidity conditions are limited. Most guidance is extrapolated from short studies on related peptides. The effect of repeated handling on a specific lot is generally not characterized.
Keep the powder dry, protected from light, and at minus 20 degrees Celsius or lower. A desiccant and a sealed vial limit moisture uptake. Let the vial reach room temperature before opening to reduce condensation.